SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9RHN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RHN0
Domain Number 1 Region: 38-97
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000638
Family Ovomucoid domain III-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RHN0
Sequence length 97
Comment (tr|A0A0D9RHN0|A0A0D9RHN0_CHLSB) Serine peptidase inhibitor, Kazal type 14 (putative) {ECO:0000313|Ensembl:ENSCSAP00000008119} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=SPINK14 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MARSFPLFSLLPFVLINLVLSSVSGPRHWWPPHGISKVKCPYKKVKFSWYNGTVNPCPGL
YQPICGTNFITYDNPCILCVESLKSHGRIRFYHDGKC
Download sequence
Identical sequences A0A0D9RHN0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]