SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9RM14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RM14
Domain Number 1 Region: 10-140
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.14e-46
Family Regulator of G-protein signaling, RGS 0.00000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RM14
Sequence length 148
Comment (tr|A0A0D9RM14|A0A0D9RM14_CHLSB) Regulator of G protein signaling 17 {ECO:0000313|Ensembl:ENSCSAP00000009653} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=RGS17 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MALFCFCSQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKK
EQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLM
HRDSFPRFLNSQIYKSFVESTAGSSSES
Download sequence
Identical sequences A0A0D9RM14

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]