SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9RM43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RM43
Domain Number 1 Region: 291-437
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.12e-24
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 
Domain Number 2 Region: 476-594
Classification Level Classification E-value
Superfamily PX domain 5.36e-24
Family PX domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RM43
Sequence length 877
Comment (tr|A0A0D9RM43|A0A0D9RM43_CHLSB) Sorting nexin 13 {ECO:0000313|Ensembl:ENSCSAP00000009682} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=SNX13 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWYYTLSDDESFLLEIRQTLQNA
LIQFATRSKEIDWQPYFTTRIVDDFGTHLRVFRKAQQKITEKDDQVKGTAEDLVDTFFEV
EVEMEKEVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPPGDFQNKIMRYFVREILARGILL
PLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNIGELEAVRDKAAEELQYLRSL
DTAGDDINTIKNQINSLLFVKKVCDSRIQRLQSGKEINTVKLAANFGKLCTVPLDSILVD
NVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQQLEVLLSRQRDGKHQTNQTKGLLRA
AAVGIYEQYLSEKASPRVTVDDYLVAKLADTLNHEDPTPEIFDDIQRKVYELMLRDERFY
PSFRQNALYVRMLAELDMLKDPSFRGSDDGDGESFNGSPTGSINLSLDDLSNVSSDDSVQ
LHAYISDTGVCNDHGKTYALYAITVHRRNLNSEEMWKTYRRYSDFHDFHMRITEQFESLS
SILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLAPEMMKASPALAHYVYDFLENKAYSK
GKGDFARKMDTFVNPLRNSMRNVSNAVKSLPDSLAEGMTKMSDNMGKMSERLGQDIKQSF
FKVPPLIPKTDSDPEHRRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKERNQWLRRNIKNL
LQQLIRATYGDTINRKIVDHVDWMTSPEQVADSVKRFRDAFWPNGILAETVPCRDKSIRM
RTRVAGKTKLLAIMPDELKHIIGAETTRKGILRVFEMFQHNQLNRRMVYVFLEGFLETLF
PQYKFRELFNKLHSRSKQMQKYKQKLQTTQAPSLQKR
Download sequence
Identical sequences A0A0D9RM43

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]