SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9RXL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RXL2
Domain Number 1 Region: 10-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000102
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RXL2
Sequence length 230
Comment (tr|A0A0D9RXL2|A0A0D9RXL2_CHLSB) Rhophilin associated tail protein 1 like {ECO:0000313|Ensembl:ENSCSAP00000013351} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=ROPN1L OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MPLPDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLQWSAGYFSALSRGDPLPVKDR
MEMPTATQKTDTGLTQGLLKILHKQCHHKQYVELTDLEQKWKNLCLPKEKFKVLLQLDPC
ENRIKWINFLALGCSMLGGSLNAALKHLCEILTDDPEGGPARIPFKTFSYVYRYLAKLDT
DVSPSETESYLASLKENIDTRRNGMIGLSDFFFPKRNLLENRENSEDVGH
Download sequence
Identical sequences A0A0D9RXL2
XP_007959405.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]