SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9RY94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RY94
Domain Number 1 Region: 84-143
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000000000017
Family AN1-like Zinc finger 0.0016
Further Details:      
 
Domain Number 2 Region: 4-49
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000000262
Family AN1-like Zinc finger 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RY94
Sequence length 179
Comment (tr|A0A0D9RY94|A0A0D9RY94_CHLSB) Zinc finger AN1-type containing 2A {ECO:0000313|Ensembl:ENSCSAP00000013583} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=ZFAND2A OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MEFPDLGKHCSEKTCKQLDFLPVKCDACKQDFCKDHFTYAAHKCPFAFQKDVQVPVCPLC
NTPIPVKKGQIPDVVVSNHIDRHCDSHPGKKKEKIFTYRCSKEGCKKKEMLQMACAQCHG
NFCIQHRHPLDHSCRHGSRPTVKAGCSPMTASESKPSGDFLALAPGGLAQRLNWFTRLM
Download sequence
Identical sequences A0A0D9RY94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]