SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9S137 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9S137
Domain Number 1 Region: 24-104
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000341
Family DEATH effector domain, DED 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D9S137
Sequence length 326
Comment (tr|A0A0D9S137|A0A0D9S137_CHLSB) Death effector domain containing 2 {ECO:0000313|Ensembl:ENSCSAP00000014576} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=DEDD2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MALSGSTPAPCWEEDECLDYYGMLSLHRMFEVVGGQLTECELELLAFLLDEAPGAAGGLA
RARSGLELLLELERRGQCDESNLRLLGQLLRVLARHDLLPHLARKRRRPVSPERYSYGTS
SSSKRTEGSCRRRRQSSSSANSQQGQWETGSPPTKRQRRSRGRPSGGARRRRRGAPAAPQ
QQPEPARPSSEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQLDVFGQATAVLR
SRDLGSVVCDIKFSELSYLDAFWGDYLSGALLQALRGVFLTEALREAVGREAVRLLVSVD
EADYEAGRRRLLLMEEEGGRRPTEAS
Download sequence
Identical sequences A0A0D9S137 A0A2K5IAS9 A0A2K5TTX5 A0A2K5Y8L6 A0A2K6BL72 A0A2K6UBL0 H9FQN0 K7BL98
XP_003811820.1.60992 XP_003943254.1.74449 XP_005589454.1.63531 XP_005589456.1.63531 XP_007995162.1.81039 XP_008962418.1.60992 XP_008962419.1.60992 XP_011762875.1.29376 XP_011762876.1.29376 XP_011791943.1.43180 XP_011791944.1.43180 XP_011838303.1.47321 XP_011838310.1.47321 XP_014979568.1.72884 XP_014979569.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]