SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9VDB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9VDB3
Domain Number 1 Region: 139-210
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 3.01e-30
Family AN1-like Zinc finger 0.00023
Further Details:      
 
Domain Number 2 Region: 58-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000328
Family A20-like zinc finger 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D9VDB3
Sequence length 215
Comment (tr|A0A0D9VDB3|A0A0D9VDB3_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:LPERR02G06310.1} KW=Complete proteome; Reference proteome OX=77586 OS=Leersia perrieri. GN=4328609 OC=Oryzoideae; Oryzeae; Oryzinae; Leersia.
Sequence
MSLSPTFLWRERERRDATTRSELLPIPIHARLLLRRRLDHVKMEHKEAGCQQPEGPILCI
NNCGFFGSAATMNMCSKCHKEMIMKEEQAKLAASSIDSIVNGCDAAKELIPAGGAIAEVA
VAQVEAKMLVVQPTDVAGTSEEVAAVPKVKEGPNRCATCRKRVGLTGFNCRCGNMYCALH
RYSDKHECQFDYRTAGRNAIAKANPVVKAEKLDKI
Download sequence
Identical sequences A0A0D9VDB3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]