SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9Z3S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9Z3S1
Domain Number 1 Region: 28-99
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.000000567
Family Cystatins 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D9Z3S1
Sequence length 101
Comment (tr|A0A0D9Z3S1|A0A0D9Z3S1_9ORYZ) Cysteine proteinase inhibitor {ECO:0000256|RuleBase:RU362130} KW=Complete proteome; Reference proteome OX=40148 OS=Oryza glumipatula. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MRTSSLVLFAAVAVFGAACTAAAGDESWKTIDANDRHVQDVALWAVAETDWASATGGLTL
NTVDGAEKRFEAGVTYYRLTLEASSRVVAKYLRFQAVLYDM
Download sequence
Identical sequences A0A0D9Z3S1
OGLUM03G08020.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]