SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0AMX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0AMX9
Domain Number 1 Region: 112-174
Classification Level Classification E-value
Superfamily POZ domain 6.67e-18
Family BTB/POZ domain 0.0011
Further Details:      
 
Domain Number 2 Region: 181-224
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.00000000667
Family Skp1 dimerisation domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0AMX9
Sequence length 234
Comment (tr|A0A0E0AMX9|A0A0E0AMX9_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OGLUM07G22800.1} KW=Complete proteome; Reference proteome OX=40148 OS=Oryza glumipatula. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAEEKGKAVMPMEVEEVEVELEVDQVEDEREAETVVEAVQKAVSDALEKVEMMEEEGEAA
VAEAADKLLEEAVEKAVTEALEEALEEAGWDAAEKALSDDLEKVSLEAESARMITLESSD
GEAVKVKEASARLSKTIGNIIDDGRGDEAIPLPDVSYKTLKKVVEYCDKHADEKSDTDEQ
KEELKNWDKAFIDELAEDDDSLVKVIMASNYLKIDGLHNLASQCKTTREQIGKA
Download sequence
Identical sequences A0A0E0AMX9
OGLUM07G22800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]