SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0B3U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E0B3U9
Domain Number - Region: 56-93
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00051
Family SMI1/KNR4-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0B3U9
Sequence length 396
Comment (tr|A0A0E0B3U9|A0A0E0B3U9_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OGLUM09G13190.1} KW=Complete proteome; Reference proteome OX=40148 OS=Oryza glumipatula. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MVDVDSRMAGLAHPAAHAAGLRRLSTRAAAGPPSASASPRHGLHSFDGVAAAVLSHLRKT
GVVVLPGLSDAEFARVEAEMGFTFPPDLRAVLAMGLPSGAGFPDWSGRAGLRAAFDLPIA
AASLQIAKGALWPRCWGRRPSDPDRARRLARSAIRRAPLLVPLFDRCYLPCRPCLAGNPV
FFITDDRVLCCGLDILHFFTRESSFQPLDVSSPSATPSSGIYTPHTRRSLDAVCGGQAPR
WIEFWSDAASDRRRRDSSSSEASTASSSSSSSGCPSPPPRSTPLWVDNYLDKLGSVLKKG
GWRDREVDEMVEVTASGLFDGEEAPPADADAVLDALFLKTDRCSDSLRRAGWTSEDVSDA
FGLDLRRRKEQPRPAVQIPPEIAAKVQRLAQAVARP
Download sequence
Identical sequences A0A0E0B3U9
OGLUM09G13190.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]