SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0B910 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0B910
Domain Number 1 Region: 68-158
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.19e-20
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0B910
Sequence length 247
Comment (tr|A0A0E0B910|A0A0E0B910_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OGLUM10G05780.1} KW=Complete proteome; Reference proteome OX=40148 OS=Oryza glumipatula. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAGGEAEAAVREMVRSMGAEQLDEAIGFATMELAGRDIPFEDMFRLCDEQELRRAKKPVM
AVVSGSGEEVERIKSKLEIGEDGRPTSDSSEKTVVELLRALQTVTMTFQTLEASKIGKTI
SGLRKHSSEQVRDLAAALYKNWKALVDEHLTRKANTPPAAEKPAPTAPPKKTASNKREEA
PALVDEAKLAAAKRKLQEGYDDAASAKKQRMIQVIDAPRKKVKNWRLVAVAAAHHPGGDR
GASTTDV
Download sequence
Identical sequences A0A0E0B910
OGLUM10G05780.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]