SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0BHK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0BHK0
Domain Number 1 Region: 293-431
Classification Level Classification E-value
Superfamily ApaG-like 2.49e-29
Family ApaG-like 0.00028
Further Details:      
 
Domain Number 2 Region: 109-224
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000249
Family SMI1/KNR4-like 0.014
Further Details:      
 
Weak hits

Sequence:  A0A0E0BHK0
Domain Number - Region: 37-75
Classification Level Classification E-value
Superfamily F-box domain 0.000305
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0BHK0
Sequence length 431
Comment (tr|A0A0E0BHK0|A0A0E0BHK0_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OGLUM11G08760.1} KW=Complete proteome; Reference proteome OX=40148 OS=Oryza glumipatula. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAAPPQPQPEPEPAAGGAGLEALEGLALDTVIAKGGARQAAALACASTRLRDAAGDDALW
RRFCADDLALHAPLAPDGRALPSFKDAYKVWLESFGMYPLPLVRRVKIFWSSLKSWLSEN
FPEALKTLNKGVSEAQIQSAEDDLGFKLPLPTKLLYRFCNGQLPLSEHHRENMRMAHLGI
IGGYVFYDHLINVHLSPLEQIVEETKEFYREFYDQDDQLYVGTINLQDGEMLPCVPKSLI
RPTNTDMPQDGLLLWLEEHLRRLQNGMIKTRMLKTSRYISLFPEASPSCTSAMTNGVKVR
ASAVFAPEHPESRRPGAKCLYAYSIRLSVPEACMLGGVYYSSCQLYSRHWIIRWRDRVVS
DVNGEGVIGKYPLLTPGQEEFVYESCTPLPDSPGSVEGSFTFVPGKLSRPEGKPFEVTVA
PFPLEIPEYIF
Download sequence
Identical sequences A0A0E0BHK0
OGLUM11G08760.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]