SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0C435 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0C435
Domain Number 1 Region: 130-176
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 0.0000000235
Family Chlorophyll a-b binding protein 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0C435
Sequence length 187
Comment (tr|A0A0E0C435|A0A0E0C435_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OMERI01G19550.1} KW=Complete proteome; Reference proteome OX=40149 OS=Oryza meridionalis. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MSLAPSIPSIKVKVGGVAVSPPRHRACRSSFAVIRSSKAEGAPRRPAAPPLSPPPKTPTL
STPPTLSQPPTPVKPAAPSSSPPPSQDPEPKQAAAPVAVAAPAAAGAVTLEYQRKVAKDL
QDYFKQKKLDEADQGPFFGFLGKNEISNGRWAMFGFAVGMLTEYATGSDFVQQVKILLSN
FGIVDLD
Download sequence
Identical sequences A0A0E0C435
OMERI01G18610.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]