SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0GDD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0GDD9
Domain Number 1 Region: 47-152
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.86e-24
Family Poly(A) polymerase, PAP, middle domain 0.0011
Further Details:      
 
Domain Number 2 Region: 150-189
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 0.0000000765
Family Poly(A) polymerase, PAP, C-terminal domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0GDD9
Sequence length 213
Comment (tr|A0A0E0GDD9|A0A0E0GDD9_ORYNI) Uncharacterized protein {ECO:0000313|EnsemblPlants:ONIVA02G36170.1} KW=Complete proteome; Reference proteome OX=4536 OS=Oryza nivara (Indian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MRFRGVQVDLVYAGVCLPWCPTTWSGPQRDRSPHGIRVADEILRLVPDTAAFRTMLRCVK
HWAKARGVYSNVAGFLGGIGWAILVARMCQLYPNTSPACCSRASSASLRGRSGPARTTTA
SSASDATLRVTTEQLAVGDDVCQEIVKAGAMWVGWVESRLRQLSARVEADTSGMLLCHLH
PQAPSAVHSPGERGVRAFASIVSKSNHVAVSAN
Download sequence
Identical sequences A0A0E0GDD9
ONIVA02G36170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]