SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0GLJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0GLJ0
Domain Number 1 Region: 296-417
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 7.26e-29
Family Poly(A) polymerase, PAP, C-terminal domain 0.0034
Further Details:      
 
Domain Number 2 Region: 81-226
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.35e-23
Family Poly(A) polymerase, PAP, N-terminal domain 0.003
Further Details:      
 
Domain Number 3 Region: 224-294
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.00000000000706
Family Poly(A) polymerase, PAP, middle domain 0.0095
Further Details:      
 
Weak hits

Sequence:  A0A0E0GLJ0
Domain Number - Region: 36-41
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0GLJ0
Sequence length 447
Comment (tr|A0A0E0GLJ0|A0A0E0GLJ0_ORYNI) Uncharacterized protein {ECO:0000313|EnsemblPlants:ONIVA03G16000.2} KW=Complete proteome; Reference proteome OX=4536 OS=Oryza nivara (Indian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MSRSSRGGRQSGSSATRMASRARPGFPVAPPPPMGPPPPPPMPPVPVMYLRGVPPPPPWL
PQHLIICGLDPAAAERTDAFRSKSLLNFISRTGVLPSPEEELKRQVVVRELDKIVMGWAK
RVAYDQREQYWNTTATVLTFGSYALGAYGPESDIDAVCVGPCIASLQHHFFIVLRQMLEE
RPEVSDLHSIENAKAIHAFDPRLLAVVNEPSWRCLSGVRVNRQIMQLLPNIKPTPWRPHC
CSFMPIVMPCSPPEFCASSITRSTFNKIKEELQRGFALTKGDRNGDINWTELFAPFPYTV
RYKHFLRIVLSAPVAEELRDWVGWVKSRFRNLLLKLESIGVDCDPDPSEQADHSMIEPNV
VFFWGLMYRTSTNICIDSVKEDFMKSVTNDIYGKEKCTHSDITMSIVWPTHLPKCVYAHS
VYSQNRQNPRQFMMGNQLMNQDCNAVR
Download sequence
Identical sequences A0A0E0GLJ0
ONIVA03G16000.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]