SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0H3Q3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E0H3Q3
Domain Number - Region: 64-93
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.0183
Family Hydrophobin II, HfbII 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0H3Q3
Sequence length 110
Comment (tr|A0A0E0H3Q3|A0A0E0H3Q3_ORYNI) Uncharacterized protein {ECO:0000313|EnsemblPlants:ONIVA04G18510.1} KW=Complete proteome; Reference proteome OX=4536 OS=Oryza nivara (Indian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MRAGAASSAAENDDEEEEEADDDDEEAAAAPDSSCGREACGASHRLAGLISNRSKHGWQS
GTTGMGCDYPSQCPRGNSRPRACLLPHDGQGTLPMPVTRGSHGALLEAMA
Download sequence
Identical sequences A0A0E0H3Q3
ONIVA04G18510.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]