SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0HIZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0HIZ6
Domain Number 1 Region: 551-620
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000087
Family Rad21/Rec8-like 0.012
Further Details:      
 
Weak hits

Sequence:  A0A0E0HIZ6
Domain Number - Region: 480-551
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000812
Family Regulator of G-protein signaling, RGS 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0HIZ6
Sequence length 620
Comment (tr|A0A0E0HIZ6|A0A0E0HIZ6_ORYNI) Uncharacterized protein {ECO:0000313|EnsemblPlants:ONIVA05G29140.1} KW=Complete proteome; Reference proteome OX=4536 OS=Oryza nivara (Indian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MFYSHQLLARKAPLGQIWMAATLHSKINRKRLDKLDIIKICEEILNPSVPMALRLSGILM
GGVAIVYERKVKALYDDVSRFLIEINEAWRVKPVADPTVLPKGKTQAKYEAVTLPENIMD
MDVEQPMLFSEADTTRFRGMRLEDLDDQYINVNLDDDDFSRAENHHQENITLADNFGSGL
GETDVFNRFERFDITDDDATFNVTPDGHPQVPSNLVPSPPRQEDSPQQQENHHAASSPLH
EEAQQGGASVKNEQEQQKMKGQQPAKSSKRKKRRKDDEVMMDNDQIMIPGNVYQTWLKDP
SSLITKRHRINSKVNLIRSIKIRDLMDLPLVSLISSLEKSPLEFYYPKELMQLWKECTEV
KSPKAPSSGYYTICSFLSPFWITKGTQSSSPEQQQRNLPPQAFPTQPQVDNDREMGFHPV
DFADDIEKLRGNTSGEYGRDYDAFHSDHSVTPGSPGLSRRSASSSGGSGRGFTQLDPEVQ
LPSGRSKRQHSSGKSFGNLDPVEEEFPFEQELRDFKMRRLSDVGPTPDLLEEIEPTQTPY
EKKSNPIDQVTQSIHSYLKLHFDTPGASQSESLSQLAHGMTTGKAARLFYQACVLATHDF
IKVNQLEPYGDILISRGPKM
Download sequence
Identical sequences A0A0E0HIZ6
ONIVA05G29140.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]