SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0HZP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E0HZP4
Domain Number - Region: 65-114
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0359
Family Regulator of G-protein signaling, RGS 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0HZP4
Sequence length 209
Comment (tr|A0A0E0HZP4|A0A0E0HZP4_ORYNI) Uncharacterized protein {ECO:0000313|EnsemblPlants:ONIVA07G10110.1} KW=Complete proteome; Reference proteome OX=4536 OS=Oryza nivara (Indian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MVEYGSLRRRRWAGAVRCATKLQGLQYHLNIIGWQQDLPSHKWGDLNEDITLFRKQIKRS
SLPGNKAKIPKTVTTMLKVWVQSSSPHFISLSLKQLQSVLKKDEPLESECFNMAICKFMY
EKIQTIHKTKEAISNHCLDLQFWNATGFGKDPVHHDNVDLAKTISSWSKIHYKLSQCKSA
CPGSRWNEDINLWRQIFVNDPVLDRMVTS
Download sequence
Identical sequences A0A0E0HZP4
ONIVA07G10110.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]