SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0IRV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E0IRV4
Domain Number - Region: 36-115
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.0323
Family Cystatins 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0IRV4
Sequence length 118
Comment (tr|A0A0E0IRV4|A0A0E0IRV4_ORYNI) Cysteine proteinase inhibitor {ECO:0000256|RuleBase:RU362130} KW=Complete proteome; Reference proteome OX=4536 OS=Oryza nivara (Indian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MVVTLAAVTALLVAPAVVAATATPPAGYTTAEDVSSDFIKQVGKFAVTVYKLARGVSLYY
VSTSQCWSKPAGGGADDYWMVLTATNGAGAAGSYVATIWGIPGSESKTWKLLSFNATS
Download sequence
Identical sequences A0A0E0IRV4 A2Z711 Q94I31
ONIVA10G08760.1 LOC_Os10g26100.1|PACid:21885072 39946.BGIOSIBCE031929 39947.LOC_Os10g26100.1 OsIBCD045216 LOC_Os10g26100.1|13110.m02216|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]