SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0L651 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0L651
Domain Number 1 Region: 524-593
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000015
Family Rad21/Rec8-like 0.011
Further Details:      
 
Weak hits

Sequence:  A0A0E0L651
Domain Number - Region: 452-524
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0235
Family Regulator of G-protein signaling, RGS 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0L651
Sequence length 594
Comment (tr|A0A0E0L651|A0A0E0L651_ORYPU) Uncharacterized protein {ECO:0000313|EnsemblPlants:OPUNC05G24510.4} KW=Complete proteome; Reference proteome OX=4537 OS=Oryza punctata (Red rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MFYSHLLLARKTPLGQIWMAATLHSKINRKGLDKLDIIKICEEILNPSVPMALRLSGILM
GGVAIVYQRKVAIEINEAWRVKPVADPTVLPKGKTQAKYEAVTLPENMMDTDVEQPMLFS
EADTTRFRGMRLEDLDEKYFNVNLDDDDFSQAENHHQENITLADNFGSGLGETDVFNRFE
RFQVIWFLRHLGRKTLFSNKKSIMLPHPLFMKKLNKVNSSTWFNLFGPKFGKGGSSVKDE
QEQQKMKGQQPAKSSKRKKRREDDEVMMDNDQIMIPGNVYQTWLKDPSSLITKRRRINSK
VNLIRSIKIRDLMDLPLVSLIYSLEKSPLEFYYPKKLMQLWKECTEVKSPKAPSSGGQQS
SSPEQQQRNSPPQAFPTQPQVDNDREMGFHPVDFADDIEKLRGNTSVEYERDYDAFHSDH
SVTPGSPGLSRRSASSSGGSGRVFTPLDPEVQLPSGRSKRRQHSSGKSFGNLDPVEEELP
LEQELRGFKMRRLSDVGPTPDLLEETEPTQTPYEKKSNPIDQVTQSIHSYLKLHFDTPGA
SQSESLSQLAYGMTTAKAARLFYQACVLATHDFIKVNQLEPYGDILISRGPKIV
Download sequence
Identical sequences A0A0E0L651
OPUNC05G24510.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]