SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0LQW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0LQW7
Domain Number 1 Region: 37-171
Classification Level Classification E-value
Superfamily TRAF domain-like 7.03e-18
Family MATH domain 0.006
Further Details:      
 
Weak hits

Sequence:  A0A0E0LQW7
Domain Number - Region: 179-187
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.034
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0LQW7
Sequence length 193
Comment (tr|A0A0E0LQW7|A0A0E0LQW7_ORYPU) Uncharacterized protein {ECO:0000313|EnsemblPlants:OPUNC08G01820.1} KW=Complete proteome; Reference proteome OX=4537 OS=Oryza punctata (Red rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MGACASASRPPPSPQRHGCLQQPTLTWTASTRTTPIVQSAHAFTVYQHGLVKRTTATGEF
VRSGTFAVGGHDWTVRYYPNGDSTDEEACRQASVVLELMTVDAAATAVYELKVVDQITGE
RFVLREGKTAAFDTRNSQFSCSGVQFVETPAFLAGDFLSIECIVTIFGEPRVSKTNTMPP
PPPPPPPERSDVS
Download sequence
Identical sequences A0A0E0LQW7
OPUNC08G01820.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]