SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0NLH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0NLH8
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.56e-21
Family Poly(A) polymerase, PAP, middle domain 0.0013
Further Details:      
 
Domain Number 2 Region: 96-143
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 0.000000000765
Family Poly(A) polymerase, PAP, C-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0NLH8
Sequence length 179
Comment (tr|A0A0E0NLH8|A0A0E0NLH8_ORYRU) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORUFI02G35650.1} KW=Complete proteome; Reference proteome OX=4529 OS=Oryza rufipogon (Brownbeard rice) (Asian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MLRCVKHWAKARGVYSNVAGFLGGIGWAILVARVCQLYPNTSPACCSRASSASLRGRSGP
ARTTTASSASDATLRVTTEQLAVGDDVCQEIVKAGAMWVGWVESRLRQLSARVEADTSGV
LLCHLHPQAYATEHHKEPRRQREREAVSAAAASTPRISGRHAGAARMALRRAASSLRWP
Download sequence
Identical sequences A0A0E0NLH8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]