SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0QBI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0QBI2
Domain Number 1 Region: 98-179
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.00000000000000111
Family Skp1 dimerisation domain-like 0.00039
Further Details:      
 
Domain Number 2 Region: 47-90
Classification Level Classification E-value
Superfamily POZ domain 0.00000133
Family BTB/POZ domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0QBI2
Sequence length 216
Comment (tr|A0A0E0QBI2|A0A0E0QBI2_ORYRU) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORUFI07G23930.2} KW=Complete proteome; Reference proteome OX=4529 OS=Oryza rufipogon (Brownbeard rice) (Asian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MATGNGEAAVVEKEGEGTMVPEALEKKVVLDAAEKEEEEKDSEAEAEAEARISKLVGDMI
DNVCADHGIPLPKVDIKTVRKMAEYMNKHFAITNKEELKIWDEGFINELDGDEDKYSLFK
IIRASERVGFYGLLDLASDMVARKIKAGKAIDEIRKFLGVEKDFTKEEEEKIRRENAWAF
EDANTQAQEKASTGPAAAKRDRPPLDQQKNPDEIAP
Download sequence
Identical sequences A0A0E0QBI2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]