SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0R6Q2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0R6Q2
Domain Number 1 Region: 287-425
Classification Level Classification E-value
Superfamily ApaG-like 3.4e-28
Family ApaG-like 0.00034
Further Details:      
 
Domain Number 2 Region: 109-212
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000706
Family SMI1/KNR4-like 0.014
Further Details:      
 
Weak hits

Sequence:  A0A0E0R6Q2
Domain Number - Region: 36-75
Classification Level Classification E-value
Superfamily F-box domain 0.000113
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0R6Q2
Sequence length 425
Comment (tr|A0A0E0R6Q2|A0A0E0R6Q2_ORYRU) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORUFI11G09580.1} KW=Complete proteome; Reference proteome OX=4529 OS=Oryza rufipogon (Brownbeard rice) (Asian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAAPPQPQPEPEPAAGGAGLEALEGLALDTVIAKAGARQAAALACASTRLRDAAGDDALW
RRFCADDLALHAPLAPDGRALPSFKDAYKVWLESFGMYPLPLVRRVKIFWSSLKSWLSEN
FPEALKTLNKGVSEAQIQSAEDDLGFKLPLPTKLLYRFCNGQLPLSEHHHENMRMAHLGI
IGGYVFYDHLINVHLSPLEQIVEETKEFYHDQLYVGTINLQDGEMLPCVPKSLIRPTNTD
MPQDGLLLWLEEHLRRLQNGMIKIRMLKTSRYISLFPEASPSCTSAMTNGVKVRASAVFA
PEHPESRRPGAKCLYAYSIRLSVPEACMLGGVYYSSCQLYSRHWIIRWRDRVVSDVNGEG
VIGKYPLLTTGQEEFVYESCTPLPDSPGSVEGSFTFVPGKLSRPEGKPFEVTVAPFPLEI
PEYIF
Download sequence
Identical sequences A0A0E0J0I1 A0A0E0R6Q2
ONIVA11G09090.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]