SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0TEK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E0TEK5
Domain Number - Region: 12-38
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0471
Family Regulator of G-protein signaling, RGS 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0TEK5
Sequence length 272
Comment (tr|A0A0E0TEK5|A0A0E0TEK5_GEOS2) Cytochrome c assembly protein {ECO:0000313|EMBL:ADU95061.1} KW=Complete proteome OX=550542 OS=Geobacillus sp. (strain Y412MC52). GN=GYMC52_2682 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MVALLYELSILLYIASILFYFIDFLQQNRKANDIAFWLLSIVWLLQTVTFVSRIMETKRF
PILTMSEGLYFYAWLLITLSLVINRLLRVDFIVFFTNVLAFFILAIHTFAPSSQSPAVAE
RLVSELLIIHITLSLGAYAAFTLSFLFSVLYMLQYSLLKKKKWGARLWRMADLLRLDFLS
YVLNALGLPMLLLGLILGVIWAYIQIDHFHWYDAKVLGSFVVLLVYGVYFYKRAVRQMQG
KAIALWNIGSFLFLLVNFFLFGSLSKFHFWYS
Download sequence
Identical sequences A0A0E0TEK5
544556.GYMC61_0871 gi|261418338|ref|YP_003252020.1| WP_013524257.1.50933 WP_013524257.1.80994 gi|319767703|ref|YP_004133204.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]