SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0TU35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0TU35
Domain Number 1 Region: 18-117
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000929
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0TU35
Sequence length 123
Comment (tr|A0A0E0TU35|A0A0E0TU35_NEIMN) Uncharacterized protein {ECO:0000313|EMBL:ADZ04412.1} KW=Complete proteome OX=935589 OS=Neisseria meningitidis serogroup B (strain NZ-05/33). GN=NMBNZ0533_2044 OC=Neisseriaceae; Neisseria.
Sequence
MIKQNSFVPYPEAMLPKGFKYPQSYLKLAQSTHAINYDEQYSFPWWFENAESNISEVIDI
YFEITGIPNLLPFARNQEWAACFDISDKSGNPKIIVVNLDNTKYYETFENFDTWLKEAEN
DGW
Download sequence
Identical sequences A0A0A8F5Q9 A0A0E0TU35 A0A0G4BZF6 A0A0H5DLT5 A0A0M3GZH1 A0A0U1RH55 A0A1D3IK08 A0A1V0DRN5 A9M495 B4RQR6 D0WDE6 D6HA11 E4ZAJ1 E6MZV0 J8W8E2 Q7DD43 X5F649
122586.NMB2110 122587.NMA0320 374833.NMCC_2071 521006.NGK_2272 gi|15677928|ref|NP_275097.1| NP_275097.1.22327 WP_002218307.1.100005 WP_002218307.1.100113 WP_002218307.1.100130 WP_002218307.1.10028 WP_002218307.1.100297 WP_002218307.1.100340 WP_002218307.1.100478 WP_002218307.1.100539 WP_002218307.1.100553 WP_002218307.1.100556 WP_002218307.1.100674 WP_002218307.1.10070 WP_002218307.1.100741 WP_002218307.1.100774 WP_002218307.1.100820 WP_002218307.1.100975 WP_002218307.1.101004 WP_002218307.1.101026 WP_002218307.1.101031 WP_002218307.1.101189 WP_002218307.1.101396 WP_002218307.1.101472 WP_002218307.1.101626 WP_002218307.1.101880 WP_002218307.1.101881 WP_002218307.1.101898 WP_002218307.1.101951 WP_002218307.1.101960 WP_002218307.1.102060 WP_002218307.1.102080 WP_002218307.1.102138 WP_002218307.1.102147 WP_002218307.1.10247 WP_002218307.1.10289 WP_002218307.1.103 WP_002218307.1.10413 WP_002218307.1.10552 WP_002218307.1.10554 WP_002218307.1.10661 WP_002218307.1.10682 WP_002218307.1.10931 WP_002218307.1.10947 WP_002218307.1.11104 WP_002218307.1.11132 WP_002218307.1.11215 WP_002218307.1.11246 WP_002218307.1.11276 WP_002218307.1.11354 WP_002218307.1.11384 WP_002218307.1.11432 WP_002218307.1.11443 WP_002218307.1.1149 WP_002218307.1.11579 WP_002218307.1.11593 WP_002218307.1.11598 WP_002218307.1.11605 WP_002218307.1.11628 WP_002218307.1.11648 WP_002218307.1.11670 WP_002218307.1.11780 WP_002218307.1.11805 WP_002218307.1.1184 WP_002218307.1.11853 WP_002218307.1.12105 WP_002218307.1.12163 WP_002218307.1.12401 WP_002218307.1.12408 WP_002218307.1.12521 WP_002218307.1.12740 WP_002218307.1.12868 WP_002218307.1.12969 WP_002218307.1.13098 WP_002218307.1.13128 WP_002218307.1.13445 WP_002218307.1.13538 WP_002218307.1.13577 WP_002218307.1.13583 WP_002218307.1.13586 WP_002218307.1.13587 WP_002218307.1.13760 WP_002218307.1.13808 WP_002218307.1.13809 WP_002218307.1.13938 WP_002218307.1.13996 WP_002218307.1.14004 WP_002218307.1.14015 WP_002218307.1.14055 WP_002218307.1.14086 WP_002218307.1.14145 WP_002218307.1.14326 WP_002218307.1.14401 WP_002218307.1.14503 WP_002218307.1.14530 WP_002218307.1.14537 WP_002218307.1.14572 WP_002218307.1.14606 WP_002218307.1.14724 WP_002218307.1.14736 WP_002218307.1.14800 WP_002218307.1.14867 WP_002218307.1.14890 WP_002218307.1.15053 WP_002218307.1.15092 WP_002218307.1.15154 WP_002218307.1.15293 WP_002218307.1.15404 WP_002218307.1.15470 WP_002218307.1.15472 WP_002218307.1.15475 WP_002218307.1.15570 WP_002218307.1.15676 WP_002218307.1.1577 WP_002218307.1.15865 WP_002218307.1.15929 WP_002218307.1.1598 WP_002218307.1.15982 WP_002218307.1.16216 WP_002218307.1.16257 WP_002218307.1.16262 WP_002218307.1.16393 WP_002218307.1.16513 WP_002218307.1.16566 WP_002218307.1.16714 WP_002218307.1.16720 WP_002218307.1.17027 WP_002218307.1.17281 WP_002218307.1.17452 WP_002218307.1.17491 WP_002218307.1.17523 WP_002218307.1.17541 WP_002218307.1.17557 WP_002218307.1.17598 WP_002218307.1.17633 WP_002218307.1.17669 WP_002218307.1.17756 WP_002218307.1.17793 WP_002218307.1.17811 WP_002218307.1.17996 WP_002218307.1.17997 WP_002218307.1.18004 WP_002218307.1.18517 WP_002218307.1.18584 WP_002218307.1.18612 WP_002218307.1.18696 WP_002218307.1.18855 WP_002218307.1.18905 WP_002218307.1.18994 WP_002218307.1.19059 WP_002218307.1.19099 WP_002218307.1.19235 WP_002218307.1.19263 WP_002218307.1.19309 WP_002218307.1.19316 WP_002218307.1.1945 WP_002218307.1.19474 WP_002218307.1.19488 WP_002218307.1.19524 WP_002218307.1.19563 WP_002218307.1.19598 WP_002218307.1.19652 WP_002218307.1.19712 WP_002218307.1.19810 WP_002218307.1.19822 WP_002218307.1.19909 WP_002218307.1.20071 WP_002218307.1.20103 WP_002218307.1.2020 WP_002218307.1.20303 WP_002218307.1.2032 WP_002218307.1.20566 WP_002218307.1.20666 WP_002218307.1.20873 WP_002218307.1.2102 WP_002218307.1.21050 WP_002218307.1.21065 WP_002218307.1.21158 WP_002218307.1.21221 WP_002218307.1.21274 WP_002218307.1.21463 WP_002218307.1.21563 WP_002218307.1.21580 WP_002218307.1.21582 WP_002218307.1.21622 WP_002218307.1.21626 WP_002218307.1.21844 WP_002218307.1.21959 WP_002218307.1.21964 WP_002218307.1.22254 WP_002218307.1.22274 WP_002218307.1.22322 WP_002218307.1.22461 WP_002218307.1.22466 WP_002218307.1.22742 WP_002218307.1.2288 WP_002218307.1.22987 WP_002218307.1.22995 WP_002218307.1.23186 WP_002218307.1.23356 WP_002218307.1.23479 WP_002218307.1.23533 WP_002218307.1.23608 WP_002218307.1.23733 WP_002218307.1.23780 WP_002218307.1.24135 WP_002218307.1.24180 WP_002218307.1.24298 WP_002218307.1.24360 WP_002218307.1.24407 WP_002218307.1.24495 WP_002218307.1.24498 WP_002218307.1.24534 WP_002218307.1.24551 WP_002218307.1.24591 WP_002218307.1.24605 WP_002218307.1.24622 WP_002218307.1.2468 WP_002218307.1.24807 WP_002218307.1.24888 WP_002218307.1.24967 WP_002218307.1.25003 WP_002218307.1.25146 WP_002218307.1.25223 WP_002218307.1.25235 WP_002218307.1.25453 WP_002218307.1.25457 WP_002218307.1.25464 WP_002218307.1.25496 WP_002218307.1.25530 WP_002218307.1.2560 WP_002218307.1.25760 WP_002218307.1.25790 WP_002218307.1.25822 WP_002218307.1.25829 WP_002218307.1.25838 WP_002218307.1.25859 WP_002218307.1.25878 WP_002218307.1.25893 WP_002218307.1.25913 WP_002218307.1.25919 WP_002218307.1.2595 WP_002218307.1.25993 WP_002218307.1.26035 WP_002218307.1.26128 WP_002218307.1.26137 WP_002218307.1.26152 WP_002218307.1.26210 WP_002218307.1.26268 WP_002218307.1.26393 WP_002218307.1.26452 WP_002218307.1.26495 WP_002218307.1.26568 WP_002218307.1.26810 WP_002218307.1.26885 WP_002218307.1.26917 WP_002218307.1.2693 WP_002218307.1.27066 WP_002218307.1.27167 WP_002218307.1.27180 WP_002218307.1.27436 WP_002218307.1.27438 WP_002218307.1.27485 WP_002218307.1.27490 WP_002218307.1.27519 WP_002218307.1.27579 WP_002218307.1.27855 WP_002218307.1.27878 WP_002218307.1.28023 WP_002218307.1.28090 WP_002218307.1.28539 WP_002218307.1.28559 WP_002218307.1.28626 WP_002218307.1.28712 WP_002218307.1.2875 WP_002218307.1.28797 WP_002218307.1.29027 WP_002218307.1.29030 WP_002218307.1.29133 WP_002218307.1.29182 WP_002218307.1.29189 WP_002218307.1.29241 WP_002218307.1.29411 WP_002218307.1.29437 WP_002218307.1.29467 WP_002218307.1.29595 WP_002218307.1.29678 WP_002218307.1.29690 WP_002218307.1.29867 WP_002218307.1.29968 WP_002218307.1.30002 WP_002218307.1.30166 WP_002218307.1.30417 WP_002218307.1.30685 WP_002218307.1.30701 WP_002218307.1.30714 WP_002218307.1.30773 WP_002218307.1.30850 WP_002218307.1.30922 WP_002218307.1.30955 WP_002218307.1.30990 WP_002218307.1.3102 WP_002218307.1.31060 WP_002218307.1.3148 WP_002218307.1.3158 WP_002218307.1.31811 WP_002218307.1.31843 WP_002218307.1.31850 WP_002218307.1.31947 WP_002218307.1.3197 WP_002218307.1.31993 WP_002218307.1.32069 WP_002218307.1.32267 WP_002218307.1.32318 WP_002218307.1.32417 WP_002218307.1.32437 WP_002218307.1.32542 WP_002218307.1.32564 WP_002218307.1.32611 WP_002218307.1.32665 WP_002218307.1.3272 WP_002218307.1.32778 WP_002218307.1.32975 WP_002218307.1.33058 WP_002218307.1.33274 WP_002218307.1.33363 WP_002218307.1.33396 WP_002218307.1.33744 WP_002218307.1.33857 WP_002218307.1.33955 WP_002218307.1.34038 WP_002218307.1.3414 WP_002218307.1.34186 WP_002218307.1.34271 WP_002218307.1.34290 WP_002218307.1.34451 WP_002218307.1.34468 WP_002218307.1.34477 WP_002218307.1.34570 WP_002218307.1.34765 WP_002218307.1.34862 WP_002218307.1.35055 WP_002218307.1.35315 WP_002218307.1.35766 WP_002218307.1.35797 WP_002218307.1.35813 WP_002218307.1.35838 WP_002218307.1.359 WP_002218307.1.35931 WP_002218307.1.35998 WP_002218307.1.36245 WP_002218307.1.36415 WP_002218307.1.36440 WP_002218307.1.36490 WP_002218307.1.36606 WP_002218307.1.3663 WP_002218307.1.36743 WP_002218307.1.3679 WP_002218307.1.36815 WP_002218307.1.37094 WP_002218307.1.37162 WP_002218307.1.37499 WP_002218307.1.37727 WP_002218307.1.37787 WP_002218307.1.3779 WP_002218307.1.37920 WP_002218307.1.37958 WP_002218307.1.38013 WP_002218307.1.38045 WP_002218307.1.38054 WP_002218307.1.38116 WP_002218307.1.38134 WP_002218307.1.38153 WP_002218307.1.38201 WP_002218307.1.38239 WP_002218307.1.38295 WP_002218307.1.38348 WP_002218307.1.3854 WP_002218307.1.38592 WP_002218307.1.3868 WP_002218307.1.38726 WP_002218307.1.38801 WP_002218307.1.38837 WP_002218307.1.38907 WP_002218307.1.38959 WP_002218307.1.39024 WP_002218307.1.39077 WP_002218307.1.39086 WP_002218307.1.39248 WP_002218307.1.393 WP_002218307.1.39303 WP_002218307.1.39340 WP_002218307.1.3952 WP_002218307.1.39535 WP_002218307.1.39627 WP_002218307.1.39686 WP_002218307.1.39755 WP_002218307.1.3985 WP_002218307.1.40248 WP_002218307.1.40262 WP_002218307.1.40352 WP_002218307.1.40364 WP_002218307.1.40421 WP_002218307.1.40564 WP_002218307.1.40677 WP_002218307.1.40678 WP_002218307.1.40732 WP_002218307.1.40792 WP_002218307.1.40847 WP_002218307.1.40933 WP_002218307.1.40940 WP_002218307.1.40989 WP_002218307.1.41013 WP_002218307.1.41145 WP_002218307.1.41215 WP_002218307.1.42093 WP_002218307.1.42307 WP_002218307.1.42319 WP_002218307.1.425 WP_002218307.1.42555 WP_002218307.1.42572 WP_002218307.1.42614 WP_002218307.1.42656 WP_002218307.1.42665 WP_002218307.1.42894 WP_002218307.1.42901 WP_002218307.1.42983 WP_002218307.1.43153 WP_002218307.1.43189 WP_002218307.1.43348 WP_002218307.1.4339 WP_002218307.1.4349 WP_002218307.1.43517 WP_002218307.1.43541 WP_002218307.1.43586 WP_002218307.1.43602 WP_002218307.1.43749 WP_002218307.1.43776 WP_002218307.1.43810 WP_002218307.1.43854 WP_002218307.1.43987 WP_002218307.1.44157 WP_002218307.1.4417 WP_002218307.1.44194 WP_002218307.1.4434 WP_002218307.1.44409 WP_002218307.1.44425 WP_002218307.1.4444 WP_002218307.1.4448 WP_002218307.1.44572 WP_002218307.1.44580 WP_002218307.1.44621 WP_002218307.1.44628 WP_002218307.1.44753 WP_002218307.1.4478 WP_002218307.1.450 WP_002218307.1.45509 WP_002218307.1.45630 WP_002218307.1.45642 WP_002218307.1.45671 WP_002218307.1.457 WP_002218307.1.45832 WP_002218307.1.45863 WP_002218307.1.46137 WP_002218307.1.46190 WP_002218307.1.46359 WP_002218307.1.46520 WP_002218307.1.46523 WP_002218307.1.466 WP_002218307.1.46627 WP_002218307.1.46715 WP_002218307.1.46748 WP_002218307.1.46830 WP_002218307.1.46903 WP_002218307.1.4705 WP_002218307.1.47204 WP_002218307.1.47277 WP_002218307.1.47393 WP_002218307.1.47474 WP_002218307.1.47544 WP_002218307.1.47594 WP_002218307.1.4762 WP_002218307.1.47656 WP_002218307.1.47808 WP_002218307.1.47826 WP_002218307.1.47844 WP_002218307.1.47876 WP_002218307.1.48058 WP_002218307.1.48085 WP_002218307.1.48136 WP_002218307.1.48201 WP_002218307.1.48453 WP_002218307.1.48644 WP_002218307.1.4873 WP_002218307.1.49022 WP_002218307.1.49068 WP_002218307.1.4928 WP_002218307.1.49533 WP_002218307.1.49556 WP_002218307.1.49608 WP_002218307.1.49665 WP_002218307.1.49679 WP_002218307.1.49694 WP_002218307.1.49698 WP_002218307.1.49775 WP_002218307.1.50197 WP_002218307.1.50295 WP_002218307.1.504 WP_002218307.1.5069 WP_002218307.1.50702 WP_002218307.1.5086 WP_002218307.1.50912 WP_002218307.1.50983 WP_002218307.1.51001 WP_002218307.1.51446 WP_002218307.1.51699 WP_002218307.1.51761 WP_002218307.1.52063 WP_002218307.1.52092 WP_002218307.1.52094 WP_002218307.1.52104 WP_002218307.1.52250 WP_002218307.1.52487 WP_002218307.1.52552 WP_002218307.1.52694 WP_002218307.1.52785 WP_002218307.1.52948 WP_002218307.1.53014 WP_002218307.1.53078 WP_002218307.1.53130 WP_002218307.1.53311 WP_002218307.1.53438 WP_002218307.1.53544 WP_002218307.1.536 WP_002218307.1.53779 WP_002218307.1.53860 WP_002218307.1.54018 WP_002218307.1.54031 WP_002218307.1.54122 WP_002218307.1.54174 WP_002218307.1.54176 WP_002218307.1.54194 WP_002218307.1.54250 WP_002218307.1.54378 WP_002218307.1.54389 WP_002218307.1.54436 WP_002218307.1.54456 WP_002218307.1.54642 WP_002218307.1.54659 WP_002218307.1.54666 WP_002218307.1.54707 WP_002218307.1.54816 WP_002218307.1.5498 WP_002218307.1.55031 WP_002218307.1.55124 WP_002218307.1.55133 WP_002218307.1.55176 WP_002218307.1.55187 WP_002218307.1.55356 WP_002218307.1.554 WP_002218307.1.55406 WP_002218307.1.55433 WP_002218307.1.55764 WP_002218307.1.5594 WP_002218307.1.55987 WP_002218307.1.56090 WP_002218307.1.56109 WP_002218307.1.56168 WP_002218307.1.56186 WP_002218307.1.56256 WP_002218307.1.56290 WP_002218307.1.56375 WP_002218307.1.56376 WP_002218307.1.56511 WP_002218307.1.56544 WP_002218307.1.56686 WP_002218307.1.56763 WP_002218307.1.56813 WP_002218307.1.56859 WP_002218307.1.56890 WP_002218307.1.57008 WP_002218307.1.57030 WP_002218307.1.5706 WP_002218307.1.57062 WP_002218307.1.57146 WP_002218307.1.57238 WP_002218307.1.57270 WP_002218307.1.57289 WP_002218307.1.57363 WP_002218307.1.57372 WP_002218307.1.57375 WP_002218307.1.57387 WP_002218307.1.57388 WP_002218307.1.57485 WP_002218307.1.57626 WP_002218307.1.5766 WP_002218307.1.57695 WP_002218307.1.57856 WP_002218307.1.57901 WP_002218307.1.57927 WP_002218307.1.58178 WP_002218307.1.58184 WP_002218307.1.58235 WP_002218307.1.58285 WP_002218307.1.58469 WP_002218307.1.58501 WP_002218307.1.58880 WP_002218307.1.58882 WP_002218307.1.58971 WP_002218307.1.59122 WP_002218307.1.59153 WP_002218307.1.59161 WP_002218307.1.59180 WP_002218307.1.59188 WP_002218307.1.593 WP_002218307.1.59728 WP_002218307.1.59760 WP_002218307.1.59875 WP_002218307.1.59880 WP_002218307.1.59917 WP_002218307.1.60113 WP_002218307.1.60234 WP_002218307.1.6025 WP_002218307.1.60279 WP_002218307.1.60358 WP_002218307.1.60604 WP_002218307.1.6084 WP_002218307.1.60906 WP_002218307.1.60963 WP_002218307.1.6113 WP_002218307.1.61206 WP_002218307.1.6141 WP_002218307.1.61510 WP_002218307.1.61648 WP_002218307.1.61701 WP_002218307.1.62008 WP_002218307.1.62224 WP_002218307.1.6228 WP_002218307.1.62295 WP_002218307.1.62376 WP_002218307.1.62467 WP_002218307.1.62499 WP_002218307.1.6256 WP_002218307.1.62662 WP_002218307.1.62726 WP_002218307.1.62727 WP_002218307.1.62826 WP_002218307.1.62942 WP_002218307.1.63054 WP_002218307.1.63110 WP_002218307.1.63520 WP_002218307.1.63620 WP_002218307.1.63637 WP_002218307.1.63651 WP_002218307.1.63652 WP_002218307.1.63755 WP_002218307.1.63900 WP_002218307.1.63953 WP_002218307.1.63962 WP_002218307.1.64152 WP_002218307.1.64272 WP_002218307.1.64284 WP_002218307.1.64317 WP_002218307.1.64344 WP_002218307.1.64381 WP_002218307.1.64410 WP_002218307.1.64439 WP_002218307.1.64487 WP_002218307.1.64652 WP_002218307.1.64741 WP_002218307.1.64769 WP_002218307.1.64843 WP_002218307.1.65547 WP_002218307.1.65681 WP_002218307.1.65694 WP_002218307.1.65724 WP_002218307.1.65784 WP_002218307.1.65891 WP_002218307.1.65919 WP_002218307.1.6592 WP_002218307.1.65942 WP_002218307.1.65953 WP_002218307.1.66023 WP_002218307.1.66034 WP_002218307.1.66113 WP_002218307.1.66283 WP_002218307.1.66373 WP_002218307.1.66444 WP_002218307.1.66488 WP_002218307.1.66572 WP_002218307.1.66722 WP_002218307.1.66772 WP_002218307.1.66788 WP_002218307.1.66920 WP_002218307.1.66927 WP_002218307.1.67041 WP_002218307.1.67110 WP_002218307.1.67167 WP_002218307.1.67186 WP_002218307.1.67190 WP_002218307.1.67289 WP_002218307.1.6741 WP_002218307.1.67445 WP_002218307.1.6749 WP_002218307.1.67577 WP_002218307.1.67646 WP_002218307.1.67687 WP_002218307.1.6772 WP_002218307.1.67725 WP_002218307.1.67738 WP_002218307.1.67817 WP_002218307.1.67985 WP_002218307.1.68023 WP_002218307.1.68040 WP_002218307.1.68047 WP_002218307.1.68056 WP_002218307.1.68291 WP_002218307.1.68298 WP_002218307.1.6842 WP_002218307.1.68437 WP_002218307.1.68445 WP_002218307.1.68498 WP_002218307.1.68634 WP_002218307.1.68663 WP_002218307.1.68720 WP_002218307.1.68771 WP_002218307.1.68789 WP_002218307.1.68879 WP_002218307.1.68907 WP_002218307.1.68996 WP_002218307.1.69030 WP_002218307.1.69067 WP_002218307.1.69069 WP_002218307.1.69228 WP_002218307.1.69325 WP_002218307.1.69334 WP_002218307.1.69435 WP_002218307.1.69594 WP_002218307.1.69994 WP_002218307.1.70130 WP_002218307.1.70252 WP_002218307.1.70265 WP_002218307.1.70380 WP_002218307.1.70552 WP_002218307.1.70616 WP_002218307.1.70752 WP_002218307.1.70953 WP_002218307.1.71001 WP_002218307.1.71019 WP_002218307.1.71041 WP_002218307.1.71155 WP_002218307.1.7117 WP_002218307.1.71233 WP_002218307.1.71321 WP_002218307.1.71411 WP_002218307.1.71485 WP_002218307.1.71789 WP_002218307.1.71816 WP_002218307.1.72029 WP_002218307.1.72080 WP_002218307.1.72130 WP_002218307.1.72137 WP_002218307.1.72244 WP_002218307.1.72311 WP_002218307.1.72384 WP_002218307.1.72495 WP_002218307.1.72637 WP_002218307.1.72726 WP_002218307.1.72833 WP_002218307.1.72840 WP_002218307.1.72868 WP_002218307.1.72928 WP_002218307.1.73111 WP_002218307.1.73189 WP_002218307.1.73237 WP_002218307.1.73614 WP_002218307.1.73620 WP_002218307.1.73703 WP_002218307.1.73775 WP_002218307.1.73922 WP_002218307.1.73930 WP_002218307.1.73936 WP_002218307.1.7399 WP_002218307.1.74054 WP_002218307.1.74064 WP_002218307.1.74133 WP_002218307.1.74343 WP_002218307.1.74384 WP_002218307.1.74433 WP_002218307.1.74619 WP_002218307.1.74643 WP_002218307.1.74664 WP_002218307.1.74771 WP_002218307.1.74896 WP_002218307.1.75 WP_002218307.1.75106 WP_002218307.1.75113 WP_002218307.1.75147 WP_002218307.1.75171 WP_002218307.1.75279 WP_002218307.1.75299 WP_002218307.1.75448 WP_002218307.1.75452 WP_002218307.1.756 WP_002218307.1.75674 WP_002218307.1.75688 WP_002218307.1.7571 WP_002218307.1.75815 WP_002218307.1.75822 WP_002218307.1.75849 WP_002218307.1.76040 WP_002218307.1.76043 WP_002218307.1.7615 WP_002218307.1.76219 WP_002218307.1.76226 WP_002218307.1.76330 WP_002218307.1.76694 WP_002218307.1.76702 WP_002218307.1.7671 WP_002218307.1.7676 WP_002218307.1.76807 WP_002218307.1.76823 WP_002218307.1.76960 WP_002218307.1.77030 WP_002218307.1.77089 WP_002218307.1.7727 WP_002218307.1.773 WP_002218307.1.7744 WP_002218307.1.77580 WP_002218307.1.77601 WP_002218307.1.77619 WP_002218307.1.77679 WP_002218307.1.77864 WP_002218307.1.77907 WP_002218307.1.7798 WP_002218307.1.7807 WP_002218307.1.78114 WP_002218307.1.78133 WP_002218307.1.78231 WP_002218307.1.78239 WP_002218307.1.78247 WP_002218307.1.78303 WP_002218307.1.78448 WP_002218307.1.78497 WP_002218307.1.7854 WP_002218307.1.78664 WP_002218307.1.78732 WP_002218307.1.78753 WP_002218307.1.78786 WP_002218307.1.78846 WP_002218307.1.78905 WP_002218307.1.78972 WP_002218307.1.79000 WP_002218307.1.79147 WP_002218307.1.79345 WP_002218307.1.79388 WP_002218307.1.7942 WP_002218307.1.79489 WP_002218307.1.796 WP_002218307.1.79729 WP_002218307.1.79912 WP_002218307.1.79980 WP_002218307.1.80076 WP_002218307.1.80173 WP_002218307.1.80233 WP_002218307.1.80348 WP_002218307.1.80391 WP_002218307.1.80447 WP_002218307.1.80791 WP_002218307.1.80823 WP_002218307.1.80940 WP_002218307.1.80981 WP_002218307.1.80982 WP_002218307.1.81005 WP_002218307.1.81356 WP_002218307.1.8150 WP_002218307.1.81608 WP_002218307.1.81696 WP_002218307.1.81706 WP_002218307.1.81770 WP_002218307.1.81791 WP_002218307.1.81926 WP_002218307.1.81942 WP_002218307.1.81964 WP_002218307.1.82134 WP_002218307.1.82336 WP_002218307.1.82560 WP_002218307.1.827 WP_002218307.1.82942 WP_002218307.1.82998 WP_002218307.1.83048 WP_002218307.1.8305 WP_002218307.1.83346 WP_002218307.1.83351 WP_002218307.1.83497 WP_002218307.1.83633 WP_002218307.1.83707 WP_002218307.1.83826 WP_002218307.1.83835 WP_002218307.1.83867 WP_002218307.1.83954 WP_002218307.1.83971 WP_002218307.1.83990 WP_002218307.1.84030 WP_002218307.1.84035 WP_002218307.1.84137 WP_002218307.1.84295 WP_002218307.1.8435 WP_002218307.1.84492 WP_002218307.1.84565 WP_002218307.1.84604 WP_002218307.1.84701 WP_002218307.1.84759 WP_002218307.1.84834 WP_002218307.1.84840 WP_002218307.1.84853 WP_002218307.1.84927 WP_002218307.1.8494 WP_002218307.1.84962 WP_002218307.1.85000 WP_002218307.1.85137 WP_002218307.1.85200 WP_002218307.1.85208 WP_002218307.1.85285 WP_002218307.1.85288 WP_002218307.1.8529 WP_002218307.1.853 WP_002218307.1.85439 WP_002218307.1.8553 WP_002218307.1.85530 WP_002218307.1.8554 WP_002218307.1.85559 WP_002218307.1.85632 WP_002218307.1.85925 WP_002218307.1.85974 WP_002218307.1.85988 WP_002218307.1.86045 WP_002218307.1.86132 WP_002218307.1.86394 WP_002218307.1.86402 WP_002218307.1.86488 WP_002218307.1.86562 WP_002218307.1.86819 WP_002218307.1.86889 WP_002218307.1.86905 WP_002218307.1.86928 WP_002218307.1.86971 WP_002218307.1.86978 WP_002218307.1.87082 WP_002218307.1.87176 WP_002218307.1.87226 WP_002218307.1.87230 WP_002218307.1.87255 WP_002218307.1.87407 WP_002218307.1.87414 WP_002218307.1.87513 WP_002218307.1.87542 WP_002218307.1.87570 WP_002218307.1.87711 WP_002218307.1.87729 WP_002218307.1.87812 WP_002218307.1.87954 WP_002218307.1.88007 WP_002218307.1.88158 WP_002218307.1.8824 WP_002218307.1.88347 WP_002218307.1.88349 WP_002218307.1.8844 WP_002218307.1.88522 WP_002218307.1.88546 WP_002218307.1.8874 WP_002218307.1.88755 WP_002218307.1.89003 WP_002218307.1.89158 WP_002218307.1.89422 WP_002218307.1.8944 WP_002218307.1.89456 WP_002218307.1.89576 WP_002218307.1.89734 WP_002218307.1.89770 WP_002218307.1.89811 WP_002218307.1.90025 WP_002218307.1.90067 WP_002218307.1.90103 WP_002218307.1.90159 WP_002218307.1.90294 WP_002218307.1.90351 WP_002218307.1.90460 WP_002218307.1.90492 WP_002218307.1.9054 WP_002218307.1.90543 WP_002218307.1.90659 WP_002218307.1.90812 WP_002218307.1.90964 WP_002218307.1.91073 WP_002218307.1.91100 WP_002218307.1.9112 WP_002218307.1.91174 WP_002218307.1.91227 WP_002218307.1.91345 WP_002218307.1.91395 WP_002218307.1.91401 WP_002218307.1.91437 WP_002218307.1.91463 WP_002218307.1.91535 WP_002218307.1.91590 WP_002218307.1.91671 WP_002218307.1.91698 WP_002218307.1.91720 WP_002218307.1.91783 WP_002218307.1.91834 WP_002218307.1.91852 WP_002218307.1.91877 WP_002218307.1.91889 WP_002218307.1.91980 WP_002218307.1.92316 WP_002218307.1.92382 WP_002218307.1.92483 WP_002218307.1.92635 WP_002218307.1.9273 WP_002218307.1.92753 WP_002218307.1.92756 WP_002218307.1.92972 WP_002218307.1.93003 WP_002218307.1.93142 WP_002218307.1.93332 WP_002218307.1.93389 WP_002218307.1.93412 WP_002218307.1.93756 WP_002218307.1.93791 WP_002218307.1.93815 WP_002218307.1.93820 WP_002218307.1.93847 WP_002218307.1.93999 WP_002218307.1.94038 WP_002218307.1.94047 WP_002218307.1.94083 WP_002218307.1.94131 WP_002218307.1.94152 WP_002218307.1.94164 WP_002218307.1.94239 WP_002218307.1.94259 WP_002218307.1.9441 WP_002218307.1.94452 WP_002218307.1.94471 WP_002218307.1.94571 WP_002218307.1.94609 WP_002218307.1.94970 WP_002218307.1.9501 WP_002218307.1.95052 WP_002218307.1.95164 WP_002218307.1.9524 WP_002218307.1.95316 WP_002218307.1.95325 WP_002218307.1.95636 WP_002218307.1.9571 WP_002218307.1.95768 WP_002218307.1.95791 WP_002218307.1.95799 WP_002218307.1.9598 WP_002218307.1.96240 WP_002218307.1.96262 WP_002218307.1.96310 WP_002218307.1.96988 WP_002218307.1.97018 WP_002218307.1.97104 WP_002218307.1.97177 WP_002218307.1.97217 WP_002218307.1.97261 WP_002218307.1.97332 WP_002218307.1.97394 WP_002218307.1.97396 WP_002218307.1.97438 WP_002218307.1.97455 WP_002218307.1.9754 WP_002218307.1.97563 WP_002218307.1.97795 WP_002218307.1.97906 WP_002218307.1.98029 WP_002218307.1.98130 WP_002218307.1.98186 WP_002218307.1.98365 WP_002218307.1.98500 WP_002218307.1.98671 WP_002218307.1.98700 WP_002218307.1.98800 WP_002218307.1.98836 WP_002218307.1.98884 WP_002218307.1.98909 WP_002218307.1.98925 WP_002218307.1.98951 WP_002218307.1.98994 WP_002218307.1.99012 WP_002218307.1.9906 WP_002218307.1.99094 WP_002218307.1.99100 WP_002218307.1.99189 WP_002218307.1.99247 WP_002218307.1.99317 WP_002218307.1.99374 WP_002218307.1.99376 WP_002218307.1.99537 WP_002218307.1.99570 WP_002218307.1.99581 WP_002218307.1.99597 WP_002218307.1.99616 WP_002218307.1.99719 WP_002218307.1.99744 WP_002218307.1.99822 WP_002218307.1.99840 gi|385336701|ref|YP_005890648.1| gi|385854148|ref|YP_005900662.1| gi|385342883|ref|YP_005896754.1| gi|385337172|ref|YP_005891045.1| gi|161870976|ref|YP_001600156.1| gi|385856115|ref|YP_005902628.1| gi|385856121|ref|YP_005902634.1| gi|385852190|ref|YP_005898705.1| gi|194099762|ref|YP_002002897.1| gi|218767324|ref|YP_002341836.1| gi|385858071|ref|YP_005904583.1| gi|385325046|ref|YP_005879485.1| gi|313667560|ref|YP_004047844.1| APC83766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]