SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0U6V0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E0U6V0
Domain Number - Region: 32-75
Classification Level Classification E-value
Superfamily Cag-Z 0.00929
Family Cag-Z 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0U6V0
Sequence length 78
Comment (tr|A0A0E0U6V0|A0A0E0U6V0_ECOLX) Uncharacterized protein {ECO:0000313|EMBL:AEE59526.1} KW=Complete proteome OX=696406 OS=Escherichia coli UMNK88. GN=UMNK88_5050 OC=Enterobacteriaceae; Escherichia.
Sequence
MKIISVKEITKDSPLWSHYLARYIDSGYQAEFECEGTADKWGIYDEWDICESIADYFDVV
GDFDCDEPPRVSWRVFYL
Download sequence
Identical sequences A0A0E0U6V0
gi|386617023|ref|YP_006136689.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]