SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0USI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0USI3
Domain Number 1 Region: 27-206
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000432
Family SMI1/KNR4-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0USI3
Sequence length 208
Comment (tr|A0A0E0USI3|A0A0E0USI3_LISMM) Uncharacterized protein {ECO:0000313|EMBL:AEH91306.1} KW=Complete proteome OX=1030009 OS=Listeria monocytogenes serotype 4a (strain M7). GN=LMM7_0300 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MMANLQDRLARIQAKITALKEKDPDLNLFGSESHTYKLNQPLSNQTLTEFENAHQITLPQ
DYRAFLEQIGNGGMGPYYGLETLVDGLCASLDYKDEKYGVQTLSEPFPHTDDWTAPGYKE
GMSDEDYDAWQELCFQDKEVFGLLRIANFGCGVSINLVVNGPSYGEIWVDDRNNDNGVYP
DFYFGNEERLGFLEWYELWLDKSIEEFE
Download sequence
Identical sequences A0A0E0USI3
gi|217965636|ref|YP_002351314.1| 552536.LMHCC_2363 gi|386025588|ref|YP_005946364.1| gi|386007005|ref|YP_005925283.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]