SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0UZX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0UZX8
Domain Number 1 Region: 9-136
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.27e-20
Family SMI1/KNR4-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0UZX8
Sequence length 143
Comment (tr|A0A0E0UZX8|A0A0E0UZX8_LISMM) Uncharacterized protein {ECO:0000313|EMBL:AEH93899.1} KW=Complete proteome OX=1030009 OS=Listeria monocytogenes serotype 4a (strain M7). GN=LMM7_2894 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MDVFEKLEEFYKQHSGLKGQPATEEQIHEAEKILDAQFNKQYIHFIKQFGGAFGGISIHA
FNNGSLIGKATVIDLTLKFRKIYGETISKELSESYVVSDDGSGNPILMDTAGKITIYYHD
SGESELLYDSLQELLTLTMQKII
Download sequence
Identical sequences A0A0E0UZX8
WP_012582288.1.22383 WP_012582288.1.33039 WP_012582288.1.39552 WP_012582288.1.53566 WP_012582288.1.5472 WP_012582288.1.81693 WP_012582288.1.83236 WP_012582288.1.90135 WP_012582288.1.95256 WP_012582288.1.98375 552536.LMHCC_2748 gi|217966019|ref|YP_002351697.1| gi|386009556|ref|YP_005927834.1| gi|386028181|ref|YP_005948957.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]