SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0VQB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E0VQB4
Domain Number - Region: 143-198
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00911
Family Nuclear receptor ligand-binding domain 0.011
Further Details:      
 
Domain Number - Region: 69-168
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0745
Family Pseudo ankyrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0VQB4
Sequence length 209
Comment (tr|A0A0E0VQB4|A0A0E0VQB4_STAA5) UPF0302 protein ST398NM01_1462 {ECO:0000256|HAMAP-Rule:MF_00760} KW=Complete proteome OX=1155084 OS=Staphylococcus aureus subsp. aureus 71193. GN=ST398NM01_1462 OC=Staphylococcus.
Sequence
MKIGMTNYQDCNLKMGYLMSETLNQIKESFIEYLLFRYRFKSRIAVWVLNYIKVNEAKLA
NIHFVDTKINHHETLEIAEVGSHASAIQFTKHNIKLMNTNEIFDYIANHNCAFDIQIQFA
NVSKREQRLDDLIVAQLTESPSYQTYLHDLNSMSIDRHKHALLIDYLLHNIDLSLQMNEK
QRFYQLTQILNTLKLVNKHNQFEDLADDD
Download sequence
Identical sequences A0A0E0VQB4
gi|386729161|ref|YP_006195544.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]