SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0W927 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0W927
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000144
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0W927
Sequence length 141
Comment (tr|A0A0E0W927|A0A0E0W927_HELPX) Uncharacterized protein {ECO:0000313|EMBL:AFH98772.1} KW=Complete proteome OX=1163741 OS=Helicobacter pylori Shi169. GN=HPSH169_00290 OC=Helicobacteraceae; Helicobacter.
Sequence
METIPTNSELNWEFVEPLNEKALSGLEDQLKMGLSDAFKDFIKRSNYGFSQWRSFMVGNK
SYTFKHVLNFNLEGKGLFIDFMKSLKEWLKPEEIIFANDGYGGYYLLNTASGVALFLDTD
DGSKHALLHLKMFLKKLESRG
Download sequence
Identical sequences A0A0E0W927
gi|386752047|ref|YP_006225266.1| WP_000447917.1.51268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]