SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0XUQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0XUQ8
Domain Number 1 Region: 61-161
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000981
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0XUQ8
Sequence length 164
Comment (tr|A0A0E0XUQ8|A0A0E0XUQ8_ECO1C) Uncharacterized protein {ECO:0000313|EMBL:AFS72297.1} KW=Complete proteome OX=1133852 OS=Escherichia coli O104:H4 (strain 2011C-3493). GN=O3K_01840 OC=Enterobacteriaceae; Escherichia.
Sequence
MMTKTQINKLIKMMNNLDYPFEAPLKESFIESIIQIEFNSNSTNCLEKLCNEVSILFKNQ
PDYLTFLRAMDGFEVNGLRLFSLSIPEPSVKNLFAVNEFYRNNDDFINPDLQERLVIGDD
SISIFTYDIKSNFFEIRDNIGTENIFSSFSDFSSFLNEIMDSCS
Download sequence
Identical sequences A0A0E0XUQ8 A0A1C9CJE0 A0A222QSM2 B7L4X4
gi|410480510|ref|YP_006768056.1| gi|407479949|ref|YP_006777098.1| 585055.EC55989_3852 gi|218697127|ref|YP_002404794.1| WP_000988501.1.100499 WP_000988501.1.10080 WP_000988501.1.101359 WP_000988501.1.101845 WP_000988501.1.12344 WP_000988501.1.17172 WP_000988501.1.19147 WP_000988501.1.19581 WP_000988501.1.20159 WP_000988501.1.24575 WP_000988501.1.24939 WP_000988501.1.26270 WP_000988501.1.2642 WP_000988501.1.26613 WP_000988501.1.27060 WP_000988501.1.27856 WP_000988501.1.28683 WP_000988501.1.33341 WP_000988501.1.35465 WP_000988501.1.36042 WP_000988501.1.36812 WP_000988501.1.36975 WP_000988501.1.38629 WP_000988501.1.39690 WP_000988501.1.41752 WP_000988501.1.43137 WP_000988501.1.43177 WP_000988501.1.44029 WP_000988501.1.4449 WP_000988501.1.46616 WP_000988501.1.47050 WP_000988501.1.4857 WP_000988501.1.49124 WP_000988501.1.49774 WP_000988501.1.49954 WP_000988501.1.50418 WP_000988501.1.52691 WP_000988501.1.532 WP_000988501.1.5342 WP_000988501.1.54023 WP_000988501.1.55417 WP_000988501.1.5561 WP_000988501.1.55787 WP_000988501.1.56149 WP_000988501.1.56689 WP_000988501.1.58507 WP_000988501.1.59621 WP_000988501.1.60325 WP_000988501.1.62762 WP_000988501.1.63556 WP_000988501.1.63666 WP_000988501.1.654 WP_000988501.1.67383 WP_000988501.1.73249 WP_000988501.1.73908 WP_000988501.1.74735 WP_000988501.1.75021 WP_000988501.1.76656 WP_000988501.1.77162 WP_000988501.1.77462 WP_000988501.1.78445 WP_000988501.1.79067 WP_000988501.1.81026 WP_000988501.1.81580 WP_000988501.1.85525 WP_000988501.1.86210 WP_000988501.1.91290 WP_000988501.1.94808 WP_000988501.1.96341 WP_000988501.1.9661 WP_000988501.1.96944 WP_000988501.1.97822 WP_000988501.1.99046 WP_000988501.1.99304 WP_000988501.1.99592 YP_006777098.1.12065 gi|407471395|ref|YP_006782162.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]