SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1BYB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E1BYB5
Domain Number - Region: 33-144
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0379
Family Pseudo ankyrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E1BYB5
Sequence length 170
Comment (tr|A0A0E1BYB5|A0A0E1BYB5_BORHE) Uncharacterized protein {ECO:0000313|EMBL:AHH14168.1} KW=Complete proteome OX=1313291 OS=Borrelia hermsii MTW. GN=BHW_0048200 OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borrelia.
Sequence
MIRKIFMLLIINTSIYSRLITTSIEKRSSETNRQYSSFNLIIEEEYYTQYPKNTHEIQIY
ELTENFLKSILRNNIDYATITPTYKEANKYLLQSEIIDKDFLKYKIFKIKTIDSLFKSSA
LIYTKKGFYKLELHIGNNNKNKLEIFNLNMSYFTKNLNEISNELIFYKKY
Download sequence
Identical sequences A0A0E1BYB5
WP_025399977.1.45005 WP_025399977.1.87898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]