SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1E192 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1E192
Domain Number 1 Region: 109-160
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000000785
Family DNA repair protein Rad51, N-terminal domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E1E192
Sequence length 166
Comment (tr|A0A0E1E192|A0A0E1E192_STRSZ) DNA-binding protein {ECO:0000313|EMBL:AIA68553.1} KW=Complete proteome OX=1403449 OS=Streptococcus equi subsp. zooepidemicus CY. GN=Q426_01380 OC=Streptococcus.
Sequence
MARRYNRKKQYKLQLKRQGLLKAVINQVEQTVEKVVDKTKEAVHTASQMVTASKTETADL
QDKQSIAKKAAQPEADVASSSLADSSEVSSEKETSKASSEVLSRDAFAELAEVSELRADI
VAVLFEAGIRSAAAFSQWTEAELLALKGIGPATISKLKENGVSFKK
Download sequence
Identical sequences A0A0D1AZP6 A0A0E1E192 B4U4A2
WP_012516079.1.22562 WP_012516079.1.27133 WP_012516079.1.40009 WP_012516079.1.67851 552526.Sez_1486 gi|414564557|ref|YP_006043518.1| gi|195978588|ref|YP_002123832.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]