SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1GIT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E1GIT5
Domain Number - Region: 84-117
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00177
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E1GIT5
Sequence length 180
Comment (tr|A0A0E1GIT5|A0A0E1GIT5_CAMFE) DnaA-binding chromosome replication initiation factor {ECO:0000313|EMBL:AIR79035.1} KW=Complete proteome OX=1240980 OS=Campylobacter fetus subsp. fetus 04/554. GN=CFF04554_1142 OC=Campylobacteraceae; Campylobacter.
Sequence
MTDFIKWSLEAIRDEGSLMSWMEERRVEWAPLLASRVKYLFEGVTFIVISDEERDWFESY
FLRNINRRDNARPILPFVSLKSLYPSFNEINSKEEISLLEDMLSIAFPNGFIYFYVGKSS
SKLSLIAKSKDDSYMWLFDEQAQNSFYLSSNDDLLDIKLLSLFRLFNKSIDAVLFGKVSL
Download sequence
Identical sequences A0A0E1GIT5 A0RPZ0 W0D840
gi|118474073|ref|YP_892273.1| WP_011732088.1.1289 WP_011732088.1.1469 WP_011732088.1.16919 WP_011732088.1.17016 WP_011732088.1.36062 WP_011732088.1.38168 WP_011732088.1.39057 WP_011732088.1.40084 WP_011732088.1.41035 WP_011732088.1.42553 WP_011732088.1.42882 WP_011732088.1.44411 WP_011732088.1.46075 WP_011732088.1.46714 WP_011732088.1.48558 WP_011732088.1.51765 WP_011732088.1.5603 WP_011732088.1.59303 WP_011732088.1.60351 WP_011732088.1.62614 WP_011732088.1.63275 WP_011732088.1.68475 WP_011732088.1.71429 WP_011732088.1.74407 WP_011732088.1.77129 WP_011732088.1.77394 WP_011732088.1.81562 360106.CFF8240_1115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]