SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1MGL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E1MGL0
Domain Number - Region: 22-90
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0628
Family SMI1/KNR4-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E1MGL0
Sequence length 114
Comment (tr|A0A0E1MGL0|A0A0E1MGL0_BACCE) Thiamine transporter {ECO:0000313|EMBL:ARO20376.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=B2J90_24030 OC=Bacillus cereus group.
Sequence
MKQQLKIAELLKRIETSKQQDIELGSYEIYLFSEIELEKGQIGYRYDKHKNSLISEENGK
WKEEWIVIGYETDMGDPVFVNVSDDAYFVYTAERGTEAWQPVHIGNMDEIIKQL
Download sequence
Identical sequences A0A0E1MGL0 A0A1J9UY66 A0A2B3YBX1
WP_001971099.1.226 WP_001971099.1.28913 WP_001971099.1.30317 WP_001971099.1.31503 WP_001971099.1.51335 WP_001971099.1.6340 WP_001971099.1.7398 WP_001971099.1.7628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]