SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1PMQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1PMQ2
Domain Number 1 Region: 69-123
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000216
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E1PMQ2
Sequence length 215
Comment (tr|A0A0E1PMQ2|A0A0E1PMQ2_LACPA) Uncharacterized protein {ECO:0000313|EMBL:BAN72813.1} KW=Complete proteome OX=1226298 OS=Lactobacillus paracasei subsp. paracasei JCM 8130. GN=LBPC_2517 OC=Lactobacillus.
Sequence
MMLQPWPNLIPRPDLPTIPKTAAIPPAYFKLIQTGILPMNWWLPTKEPTSDAIDGVGIHA
FATVGPAMTSNDLPAHFLPFAKTGHQYFGFDLQQEPRQIRYIDTEVDQWLTVAMDLPAFM
KQLQPHEVKLPEISVDPQIFGHMAVIATATEWPALFDYAREFMAGQAIGPWLRWLAQSKE
EAKRQVGMEEFHFLTRYQPNFLTPNDTLTLQHVFG
Download sequence
Identical sequences A0A0E1PMQ2 C2F9Q2 S2Q3V1
WP_003662690.1.57088 WP_003662690.1.72586 WP_003662690.1.91826 WP_003662690.1.96019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]