SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1RV65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E1RV65
Domain Number - Region: 7-66
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 0.0759
Family HIN-200/IF120x domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E1RV65
Sequence length 161
Comment (tr|A0A0E1RV65|A0A0E1RV65_COCIM) Uncharacterized protein {ECO:0000313|EMBL:EAS29197.2} KW=Complete proteome; Reference proteome OX=246410 OS=Coccidioides immitis (strain RS) (Valley fever fungus). GN=CIMG_07943 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MELLHVAVAGMFCVDIWRRHGGALHFEVSRCFGAGRVYSMYEWVSYGCRRGIKCDLLRIH
YSDAENSKAKLSLNDCYDGTVHAFQELCCTAVVAHHRFREEIGGERLVSRRRSRPKLDDN
ANTRLQHDRYRPARIIMQCDLPRRLQSTDTQICSVACAKDT
Download sequence
Identical sequences A0A0E1RV65
CIMG_07943T0 XP_001240780.2.59393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]