SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1RZB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1RZB1
Domain Number 1 Region: 22-229
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.13e-27
Family Heat shock protein 90, HSP90, N-terminal domain 0.016
Further Details:      
 
Weak hits

Sequence:  A0A0E1RZB1
Domain Number - Region: 1372-1442
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0377
Family Regulator of G-protein signaling, RGS 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E1RZB1
Sequence length 1728
Comment (tr|A0A0E1RZB1|A0A0E1RZB1_COCIM) Uncharacterized protein {ECO:0000313|EMBL:EAS37359.1} KW=Complete proteome; Reference proteome OX=246410 OS=Coccidioides immitis (strain RS) (Valley fever fungus). GN=CIMG_02713 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MAGNVDFNALKARAIESGLDEEAVTVNTRALIDKVLARYSGEWTVLRELLQNAADASATQ
VIIKLETLPSTAVPIPPTDDAAASIKHVISHHTVKSLILKNNGIPFSANDWSRLKRIAEG
NPDETKIGAFGVGFYSVFSECEEPFVSSGKEAIAFYWKENALFTRRLQLQDQDCSPDTTF
VLDYRNTTSPIPALLPLCQFLASSLTFIGLQAIELWLDGWNLLKLSKKIAPGLSVNIPRD
VQTKTSEGLMKVQGVTREVVQLDASWMPAVEWKSPTNSSRFEGTRGDDNTSSLRSFFSRL
TRSAGGKLADNTADNGKPSQAPIPENLTLFTSSSVFLHINTAKIQTSVGHSFGQELLRAT
KKPAPKFTSLAVLTSSFASMQLSDESGTSNTKSIFATVLPSKSGRVYIGFPTHQTTGMGA
HISAPSIIPTVERESIDLNARWVRTWNTELLRASGIVCRIAWAAEMATIKDRIASLASRS
GRTTPQMDDIVPVVPEAAHISNQFVFHQSTPATQVAQVIENSFWTCSQNGYLEVLSTCGV
LPTHKIRLAPKDLSFMDSIPVIPDSLMDQSKGFISRIIDFGLITDITVSDIKRELESKPL
SAKQLSEFLSWLVEKAVNHEFDRATINALLSVVVANDELDGVPSGILVLRDISSFLNPSR
IPADLPIPSSVMPFKYTKNLQANQLSSLGWYELQIDSWVRWLVESDLSSSLPLEQCITRT
PSFSARILPIVSKQWDGLSPQSKTAISNLLQQHTVVPTRSGMRKPPEAYFPSVRLLEDLP
VVHGLNNVKEKFLVGLGVRKTVDLNVIFERLLGASTDTKEDKVNRPRWSHVELIKYLTTV
RSDIPKGDIAKLKQVRFCTAEANGATAMSDKRYRVCELFEPKQSLRDLDMPLLYWPGPYP
SGSAEAQFLTLLGLRSYPSAPELVQLIAQAASERNIHLRDKALAYFISTHVINGYGDFDY
AKVTLPFLPLEDGTHGAPSQCFTDRGALLFGFKLLRRDLEAHASKFGVKQHPPINDCLNI
LVREPPKSASQAKELFQYFAKRLAEINSSTADRIGRAAIVPTNRGPQPGRGHTEKKSANL
IHIAPQDCYLGGSEDYMDIFDFVDFGAEANLFLLACGSKREPTTVELASMLVKDYARIVD
KLQNPEKYLKLLRSIADNMDQIKRDRNLIRDMKKVNFLLASRELPSKTKSEGIDDAHEEE
EALVREWQLVKAADAVIVDDYASFSLFKESVLAAPQEEALEDMYVQLGAPNLGSIVVEDV
RCGYAAPDQRNAIKLQKQIHERARLFLHDLPKEVIKHDAKWLENHLTVQVVQSISLRRSL
RGRNTGHVEKRSAVVSRRQNNSNPILCISPGDINFYQVSQALVHEILLRPKLHSTLTLEM
LLKTDLLELRVRGYNVERILRQKAAAAKMAESQRQMQVEEDRRRLEQVEQERQRRQEQEL
NENENLHPMPGVFPDFIPNFRPNRGADSSLTSSNNDGGMAGFISGLGRRFGLDELLRGGN
SAPTDRSSTPSTPPPPYTPQQENNPDNPGPHSGISPSILRQNLTTAITRCRPHGHSAIQS
TRQVTQISDAKSYCDEQPGHDLVQVANIADTTLRFFLPRSSEQLSTFYKTHEAALIHFAS
ILMDCASIFGLRKDSISVFCEPNGKTIAFNHQGSIFCNFHYFQNLHLAKVTEGSRADTLV
YWWTIFCHELAHNIVELHNSEHSYYTESFVMEYFPGIAAKLQSYQNAR
Download sequence
Identical sequences A0A0E1RZB1
XP_001248942.1.59393 CIMG_02713T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]