SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1RZC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1RZC7
Domain Number 1 Region: 10-59,171-253
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-22
Family Regulator of G-protein signaling, RGS 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E1RZC7
Sequence length 367
Comment (tr|A0A0E1RZC7|A0A0E1RZC7_COCIM) RGS domain-containing protein {ECO:0000313|EMBL:EAS35236.1} KW=Complete proteome; Reference proteome OX=246410 OS=Coccidioides immitis (strain RS) (Valley fever fungus). GN=CIMG_00590 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MASSSSIQEEEHRNRLPTLLEVLSRRTLAPVDLFSFYIYMRDQQCSVDYLDFWLDVSQHM
SLCRHYVRELRRSVLLETPEPEKLDSESPGLAPNGAGPSGPGYPFDGLGHDNDQRLSAFL
RSEGRPSMYSARSSMDSGRSGRRFSSVDRPRRVSDMFPQQHHNNSNGSPGHTVARSDIRA
SAVRILYTYLLPGSEREVVLPDTIVGDIVHMIEQEGRDDPEVFDTAKDYVFQAMERDAFP
GFLQAKALGNLVPPSILARLVLALTSLGGGFWGAFYVVLTDQPRHVRCWVILPFIVGAYF
LASYQYRMDPILAFIGFSEYTFMNWTSVREPYIRSLLLKRAFVSLAFATFIAVALCVLFI
FVPGTRL
Download sequence
Identical sequences A0A0E1RZC7 A0A0J6XW90
CIRT_00613 CIMG_00590T0 XP_001246819.1.59393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]