SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1SPJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1SPJ7
Domain Number 1 Region: 391-616
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.00000265
Family Rhamnogalacturonan acetylesterase 0.055
Further Details:      
 
Weak hits

Sequence:  A0A0E1SPJ7
Domain Number - Region: 279-335
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0222
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E1SPJ7
Sequence length 631
Comment (tr|A0A0E1SPJ7|A0A0E1SPJ7_HAEIF) Conserved hypothetical acyltransferase {ECO:0000313|EMBL:EDK12200.1} KW=Complete proteome OX=374933 OS=Haemophilus influenzae PittII. GN=CGSHiII_08281 OC=Pasteurellaceae; Haemophilus.
Sequence
MSSIKYRPEIDGLRAIAVISVIIYHLNENWLSGGFLGVDIFFVISGFLITGIIITEIQQN
SFSFKQFYTRRIKRIYPAFITVMALVSLIASAIFIYNDFNQLRKTIELATAFLSNFYLGL
TQGYFDLSANENPVLHIWSLAVEEQYYLIFPLILILAYKKFREIKVLFIITLILFFILLA
TSFIPANFYKEVLHQPNIYYLSNLRFPELLVGSLLAIYHNLSASKQASKQASKQASNVIA
ILSTLLLFSCLFLMNNDIAFIPGVTLILPCIFTALIIHTTSQNNIVKLCLSNKAIVFIGK
ISYSLYLYHWIFIAFAYYITGSKQIQGITVLIVVILTIIFSITSYYLIEQPIRKSKLNFK
QAFIYLYLIPSLFIIGYNTYERKQIRKEKEHIEQDVLSVNLENNFPTTVLTIGDSHAGHL
TYFLKYLGKQEGWKSTILSITDGKDCFVLVDKNNKITPECQGLLDEINSPKYKAIFISGF
YDLRMGGQPVPRFNAQASFIDNFKTRFVETVKLLAKSKSVYIFANNSSISRSPVRGYLLE
KYGLEKYLEPIRRMGDIDASNKIIHDLVKDIPNVYWVDAQQYLPKDSVMAEGKYLYGDQD
HLTNFGAYYMAKEFSKYQRVMTPEQVKKLYE
Download sequence
Identical sequences A0A0E1SPJ7
WP_005666570.1.20018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]