SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1SXE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E1SXE4
Domain Number - Region: 13-83
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.000536
Family PspA lactotransferrin-binding region 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E1SXE4
Sequence length 85
Comment (tr|A0A0E1SXE4|A0A0E1SXE4_ECOLX) Putative bacteriophage protein {ECO:0000313|EMBL:EDU63576.1} KW=Complete proteome OX=344610 OS=Escherichia coli 53638. GN=Ec53638_4009 OC=Enterobacteriaceae; Escherichia.
Sequence
MNNQTMTFTPEQLRKHAQEMLRHAEQLEKTGITKDAIRKDMVPALRELMQAKHRAQKAVD
ELVDCVAELETRVGKFEKLVQEALR
Download sequence
Identical sequences A0A0E1SXE4 A0A0F6MFT6 A0A0H2UXW8 D2AA47 F5NWY8 I6C062 I6H7Z5 Q0T1M6
gi|30062225|ref|NP_836396.1| gi|384542283|ref|YP_005726345.1| 198214.SF0687 198215.S0724 373384.SFV_2698 gi|24112105|ref|NP_706615.1| APC27366 NP_706615.1.23235 gi|110806574|ref|YP_690094.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]