SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1U8L5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E1U8L5
Domain Number - Region: 113-171
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0722
Family AadK C-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E1U8L5
Sequence length 183
Comment (tr|A0A0E1U8L5|A0A0E1U8L5_BORBG) Uncharacterized protein {ECO:0000313|EMBL:EEF56188.1} KW=Complete proteome OX=498740 OS=Borrelia burgdorferi 64b. GN=BBU64B_0687 OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borreliella.
Sequence
MKNNISDIFFKYNVVIYKFLNSKKEHMIRVLLGSLAVSFLFSICMVFLNYDNLFSKRVFY
FHSSKGFVANLRYLRDEQNLKDNLDLLVKDFLLGSNEGFSFGFLLSDARLLYSFLKNGVY
YVNLSREFYDSFNNGDYNESNESFDVKVNLFAMSLIKTMRFNYPGKLKKIVILVEGCILK
EQS
Download sequence
Identical sequences A0A0E1U8L5
WP_002665719.1.86244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]