SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1VBS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E1VBS0
Domain Number - Region: 68-170
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.0706
Family ETX/MTX2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E1VBS0
Sequence length 206
Comment (tr|A0A0E1VBS0|A0A0E1VBS0_STAEP) Uncharacterized protein {ECO:0000313|EMBL:EES35763.1} KW=Complete proteome OX=525376 OS=Staphylococcus epidermidis W23144. GN=HMPREF0791_1629 OC=Staphylococcus.
Sequence
MLTLSKGIEPGDWLTFFGTLVGALIGALIAGGIAIYVAHLQNKHQNNYIEKQNELDKRVK
KYELNTKMINDSMHNLNDNYFRVTKLYYDLLTEKDKDSQRRLVGELIATKNKITNYTITY
KDYLLKNTDFSNDSNDLKEATDKVINKTKSFGEELARIGSTSEVNGVNTSDVKCIGENIK
SMAPLIYELNQELQNTLSQQLKRTYK
Download sequence
Identical sequences A0A0E1VBS0 A0A2G7KBB5
WP_002446791.1.37086 WP_002446791.1.68882 WP_002446791.1.7614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]