SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1VIT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1VIT1
Domain Number 1 Region: 9-86
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000392
Family SMI1/KNR4-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E1VIT1
Sequence length 89
Comment (tr|A0A0E1VIT1|A0A0E1VIT1_STAEP) Uncharacterized protein {ECO:0000313|EMBL:EES35247.1} KW=Complete proteome OX=525376 OS=Staphylococcus epidermidis W23144. GN=HMPREF0791_2109 OC=Staphylococcus.
Sequence
MKVLYGCDTPYDVTNIEYWMDEYESELIEESIIIGNDLSQGFLVLILLEGYEGVYFWDDG
HNFESSNDEENTYFIAETFTNFLKKIQYK
Download sequence
Identical sequences A0A0E1VIT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]