SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1VLI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1VLI7
Domain Number 1 Region: 3-165
Classification Level Classification E-value
Superfamily BH3703-like 8.11e-60
Family BH3703-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E1VLI7
Sequence length 166
Comment (tr|A0A0E1VLI7|A0A0E1VLI7_STAA3) Uncharacterized protein {ECO:0000313|EMBL:EES94346.1} KW=Complete proteome OX=450394 OS=Staphylococcus aureus subsp. aureus USA300_TCH959. GN=HMPREF0776_1032 OC=Staphylococcus.
Sequence
MTFEEKQSEMYNKIANEISGMIPVEWEKVYTIAYVDNQGGEVIFNYTKPGSEELNYYSDI
PKDFNVSNDIFMDLWMKVYRMFDELRETFKKERFEPWTSCEFDFTRDGNLNVSFDYIDWL
NTEFDQLSLENYYMYKKFGVIPEMEYEMEEIKEIEQYIKEQEEAEQ
Download sequence
Identical sequences A0A0E1VLI7 T1Y5S3
gi|537460025|ref|YP_008490465.1| WP_000142154.1.100357 WP_000142154.1.100612 WP_000142154.1.10355 WP_000142154.1.14924 WP_000142154.1.15478 WP_000142154.1.15507 WP_000142154.1.22180 WP_000142154.1.25262 WP_000142154.1.2592 WP_000142154.1.2725 WP_000142154.1.29554 WP_000142154.1.30115 WP_000142154.1.30962 WP_000142154.1.34128 WP_000142154.1.4057 WP_000142154.1.46911 WP_000142154.1.48205 WP_000142154.1.52224 WP_000142154.1.55100 WP_000142154.1.619 WP_000142154.1.64473 WP_000142154.1.70089 WP_000142154.1.75048 WP_000142154.1.83508 WP_000142154.1.85132 WP_000142154.1.8617 WP_000142154.1.89857 WP_000142154.1.92297 WP_000142154.1.92541 WP_000142154.1.95571 WP_000142154.1.96474 WP_000142154.1.97004 WP_000142154.1.97468 WP_000142154.1.97720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]