SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1WTF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1WTF4
Domain Number 1 Region: 307-402,474-636
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.49e-49
Family Tandem AAA-ATPase domain 0.000033
Further Details:      
 
Domain Number 2 Region: 114-384
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.79e-36
Family Tandem AAA-ATPase domain 0.00000593
Further Details:      
 
Weak hits

Sequence:  A0A0E1WTF4
Domain Number - Region: 404-495
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00379
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E1WTF4
Sequence length 640
Comment (tr|A0A0E1WTF4|A0A0E1WTF4_HAEIF) Helicase/nuclease RecBCD subunit RecD {ECO:0000256|HAMAP-Rule:MF_01487} KW=Complete proteome OX=656913 OS=Haemophilus influenzae NT127. GN=HIAG_00881 OC=Pasteurellaceae; Haemophilus.
Sequence
MLSVLHKLKEQHILSQGDYYFAKLIADKQCHMDYAEPIKNLAILLAALCSWRYTQGNTCS
QLDRYLEHNLFGLAYRTTEEDYLAEIHEKIGYLPVEDWQNALCGHMAFTQDPVNQIAPMA
FQFGALYFYRAWQDEYRIAQYIKNTLKKYRTLAFSYDEIHQKLEKYFPEKQEKTDWQKVA
VATAIKSPFSIITGGPGTGKTTTVTRLLLVLQELFDCKLHIKLVAPTGKAASRLEESIKN
ALGFMQEKMNVSDSLFNAIPQKASTLHSLLGVNAFNDYTRYNSHNPLQLDVLVVDETSMI
DLPMMAKLINALKPETRLILLGDQAQLASVEAGAVLGELAQFVNQPYSHEQATYLQATTG
YKVECSDSSNPIRDCLCHLTESRRFDKDSGIGKLSEFIQKGKADDSLELFDHYPQELHFN
ALNDESNAVNQVVKSAVENYRTFLKMLDDLRKQKIDPNAKNEQGISYAEAIQAQFNSVRF
LTALRNNNLGVENLNKEIALALREQKLLWFRNEQDWYIGKSIMITENDHNVRLYNGDIGL
CLANGKVWFGNREVLTNRIPAHEPAFMMTIHKSQGSEFEHTVMVLPTEVNPVLSRELVFT
GVTRAKKELTVFADEKIWKTAIRQTVKRQSGLGKLLEDLN
Download sequence
Identical sequences A0A0E1WTF4
WP_005691629.1.32414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]