SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1XDH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E1XDH1
Domain Number - Region: 42-100
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0377
Family SMI1/KNR4-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E1XDH1
Sequence length 133
Comment (tr|A0A0E1XDH1|A0A0E1XDH1_STRGY) Uncharacterized protein {ECO:0000313|EMBL:EFM28859.1} KW=Complete proteome OX=545774 OS=Streptococcus gallolyticus subsp. gallolyticus TX20005. GN=HMPREF9352_2020 OC=Streptococcus.
Sequence
MKKFIVVVGCTFGLLFSLLGANGYLVASDVDASTVSHKTGNYTIDKILSSYEDEEFFTKD
YVDEMFNDWSIDENTKVIADEEGGLFYSLTNNHAVLKTYDTDSGQVVEELSLDSPRATTV
GDLKEALYEALEE
Download sequence
Identical sequences A0A0E1XDH1
WP_009855054.1.2742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]