SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1YA34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E1YA34
Domain Number - Region: 87-139
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0134
Family Regulator of G-protein signaling, RGS 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E1YA34
Sequence length 141
Comment (tr|A0A0E1YA34|A0A0E1YA34_LISMN) Uncharacterized protein {ECO:0000313|EMBL:EFR86270.1} KW=Complete proteome OX=702458 OS=Listeria monocytogenes FSL F2-208. GN=NT04LM_0101a OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
AVKEQIERISTRIENINFLKANLLQSKFDENKLLSFHNIEESKYFLDELLIFMQDMSWPI
AKNAVPILLENQKYLKESIVKAFKSEDNTWIYNILYFLMKEFEEESIYCYQIELEKLEKN
ASISAVQEVAETILKKFFRKA
Download sequence
Identical sequences A0A0E1YA34

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]