SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1YJ56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E1YJ56
Domain Number - Region: 66-134
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.00494
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E1YJ56
Sequence length 178
Comment (tr|A0A0E1YJ56|A0A0E1YJ56_MORCA) Uncharacterized protein {ECO:0000313|EMBL:EGE22136.1} KW=Complete proteome OX=857573 OS=Moraxella catarrhalis CO72. GN=E9W_09827 OC=Moraxellaceae; Moraxella.
Sequence
MMIYFDFNNEKILDSLKATLTRDNLGDLYIDLQKTPPKNIKTYFSISYFDHILSEEEYIN
EKFVCYSNITKSSSDNLIAELNKVMNNFLRLYDFLFDLNDDFVYIDNNSSIIKTKNKDLY
VRNVINGLKERPLCTLVFSNLKLMVEIGYDLTHHFYFVENTHFEKIKEMVLLNKLFII
Download sequence
Identical sequences A0A0E1YJ56
WP_003661459.1.28780 WP_003661459.1.41142 WP_003661459.1.81842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]